PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000402013
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 212aa    MW: 23789.1 Da    PI: 9.8831
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000402013genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.56.4e-181360148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W+++Ed++l+d+++++G g+W++ ++  g++R++k+c++rw +yl
    MDP0000402013 13 KGAWSKQEDQKLIDYIQKHGEGRWNSLPKAAGLRRCGKSCRLRWINYL 60
                     79********************************************97 PP

2Myb_DNA-binding42.51.5e-1367135247
                      SSS-HHHHHHHHHHHHHTTTT........................-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGgg........................tWktIartmgkgRtlkqcksrwqky 47 
                      g+  ++E++l+++++++lG++                        +W++Ia +++ gRt++++k++w+++
    MDP0000402013  67 GSIGEDEEDLIIRLHALLGNRdkqvalyysggdeccpypvawvriSWSLIAGRLP-GRTDNEVKNYWNSH 135
                      66679**************************************************.***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.985864IPR017930Myb domain
SMARTSM007171.9E-141262IPR001005SANT/Myb domain
PfamPF002491.5E-161360IPR001005SANT/Myb domain
SuperFamilySSF466893.27E-231364IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.3E-231467IPR009057Homeodomain-like
CDDcd001672.08E-111560No hitNo description
SMARTSM007171.1E-1065138IPR001005SANT/Myb domain
PROSITE profilePS512949.30465140IPR017930Myb domain
PfamPF002491.7E-1166135IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-2068140IPR009057Homeodomain-like
CDDcd001675.45E-771136No hitNo description
SuperFamilySSF466893.27E-23109137IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
MRKPGCDKIE TNKGAWSKQE DQKLIDYIQK HGEGRWNSLP KAAGLRRCGK SCRLRWINYL  60
RPDLKRGSIG EDEEDLIIRL HALLGNRDKQ VALYYSGGDE CCPYPVAWVR ISWSLIAGRL  120
PGRTDNEVKN YWNSHIRKKL SKMGSTLDPK KPHDHHDPHL RRGTTAGVPV LQPDARKPIL  180
FASSSSDSMS TGAKIHSNES GLPDLNLDLS L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-251014024128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.296041e-102leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4012204e-66AF401220.1 Fragaria x ananassa transcription factor MYB1 (MYB1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008393410.11e-122PREDICTED: myb-related protein Zm38-like
TrEMBLM5WGQ16e-81M5WGQ1_PRUPE; Uncharacterized protein
STRINGPOPTR_0010s12420.12e-70(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26434221
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09460.15e-58myb domain protein 6